Structure of PDB 8i0w Chain U Binding Site BS01

Receptor Information
>8i0w Chain U (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYNGIGLPTPRGSGTNGYVQRNLSLVPDILDHERKRRVELRCLELEEMME
EQGYEEQQIQEKVATFRLMLLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8i0w Molecular basis for the activation of human spliceosome
Resolution3.4 Å
Binding residue
(original residue number in PDB)
M1 T15 N16 Y18 V19 R21
Binding residue
(residue number reindexed from 1)
M1 T15 N16 Y18 V19 R21
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0070742 C2H2 zinc finger domain binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8i0w, PDBe:8i0w, PDBj:8i0w
PDBsum8i0w
PubMed39068178
UniProtQ9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 (Gene Name=SRRM2)

[Back to BioLiP]