Structure of PDB 7w59 Chain U Binding Site BS01

Receptor Information
>7w59 Chain U (length=72) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MYNGIGLPTPRGSGTNGYVQRNLSLVPDILDHERKRRVELRCLELEEMME
EQGYEEQQIQEKVATFRLMLLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7w59 Mechanism of exon ligation by human spliceosome.
Resolution3.6 Å
Binding residue
(original residue number in PDB)		T15 N16 Y18 V19 R21
Binding residue
(residue number reindexed from 1)		T15 N16 Y18 V19 R21
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0005515 protein binding
GO:0070742 C2H2 zinc finger domain binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0015030 Cajal body
GO:0016607 nuclear speck
GO:0071005 U2-type precatalytic spliceosome
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7w59, PDBe:7w59, PDBj:7w59
PDBsum7w59
PubMed35705093
UniProtQ9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2 (Gene Name=SRRM2)

[Back to BioLiP]