Structure of PDB 7uvz Chain U Binding Site BS01

Receptor Information
>7uvz Chain U (length=97) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANFVLNAQARAEDKQGKGASRRLRRESLVPAIIYGGNAEPVAVTLELREL
VKALESNVFFEEVVEIKVGDKVENVKIQALQRHPAKNTPMHADFKRA
Ligand information
>7uvz Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu
<<<<<<<<.....<<<<<<<.....<<<<<<...............>>>.
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7uvz Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
Resolution2.21 Å
Binding residue
(original residue number in PDB)		R11 Q16 K18 S21 R22 R23 R25 R26 I33 Y35 Q79 Q82 H92
Binding residue
(residue number reindexed from 1)		R10 Q15 K17 S20 R21 R22 R24 R25 I32 Y34 Q78 Q81 H91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvz, PDBe:7uvz, PDBj:7uvz
PDBsum7uvz
PubMed37192172
UniProtB7I7B6|RL25_ACIB5 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]