Structure of PDB 7s78 Chain U Binding Site BS01

Receptor Information
>7s78 Chain U (length=165) Species: 28285 (Human adenovirus 5) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSKEIPTPYMWSYQPQMGLAAGAAQDYSTRINYMSAGPHMISRVNGIRAH
RNRILLEQAAITTLTIRGRGIQLNDESVSSSLGLRPDGTFQIGGAGRPSF
TPRQAILTLQTSSSEPRSGGIGTLQFIEEFVPSVYFNPFSGPPGHYPDQF
IPNFDAVKDSADGYD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7s78 Structure of a Cell Entry Defective Human Adenovirus Provides Insights into Precursor Proteins and Capsid Maturation.
Resolution3.72 Å
Binding residue
(original residue number in PDB)		R165 L169
Binding residue
(residue number reindexed from 1)		R103 L107
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019028 viral capsid
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7s78, PDBe:7s78, PDBj:7s78
PDBsum7s78
PubMed34774568
UniProtP24936|CAP8_ADE05 Pre-hexon-linking protein VIII (Gene Name=L4)

[Back to BioLiP]