Structure of PDB 7ryh Chain U Binding Site BS01

Receptor Information

>7ryh Chain U (length=97) Species: 480119 (Acinetobacter baumannii AB0057)

ANFVLNAQARAEDKQGKGASRRLRRESLVPAIIYGGNAEPVAVTLELREL
VKALESNVFFEEVVEIKVGDKVENVKIQALQRHPAKNTPMHADFKRA

Ligand information

>7ryh Chain B (length=115)

gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu

<<<<<<<<.....<<<<<<<.....<<<<<<...............>>>.
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7ryh An Analysis of the Novel Fluorocycline TP-6076 Bound to Both the Ribosome and Multidrug Efflux Pump AdeJ from Acinetobacter baumannii.
• Resolution: 2.43 Å
• Binding residue (original residue number in PDB): R11 Q16 K18 R23 R25 R26 I33 Y35 P41 Q79 Q82 H92 K96
• Binding residue (residue number reindexed from 1): R10 Q15 K17 R22 R24 R25 I32 Y34 P40 Q78 Q81 H91 K95

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ryh, PDBe:7ryh, PDBj:7ryh
• PDBsum: 7ryh
• PubMed: 35100868
• UniProt: B7I7B6|RL25_ACIB5 Large ribosomal subunit protein bL25 (Gene Name=rplY)