Structure of PDB 7ryg Chain U Binding Site BS01

Receptor Information
>7ryg Chain U (length=97) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ANFVLNAQARAEDKQGKGASRRLRRESLVPAIIYGGNAEPVAVTLELREL
VKALESNVFFEEVVEIKVGDKVENVKIQALQRHPAKNTPMHADFKRA
Ligand information
>7ryg Chain B (length=115) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu
<<<<<<<<.....<<<<<<<.....<<<<<<...............>>>.
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ryg An Analysis of the Novel Fluorocycline TP-6076 Bound to Both the Ribosome and Multidrug Efflux Pump AdeJ from Acinetobacter baumannii.
Resolution2.38 Å
Binding residue
(original residue number in PDB)		R11 Q16 K18 R23 R25 R26 Y35 P41 Q82 H92
Binding residue
(residue number reindexed from 1)		R10 Q15 K17 R22 R24 R25 Y34 P40 Q81 H91
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ryg, PDBe:7ryg, PDBj:7ryg
PDBsum7ryg
PubMed35100868
UniProtB7I7B6|RL25_ACIB5 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]