Structure of PDB 7nvt Chain U Binding Site BS01

Receptor Information
>7nvt Chain U (length=113) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMGQVEEEP
LNSEDDVSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGR
DYIFSKAIGDAEW
Ligand information
>7nvt Chain T (length=50) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaagagagtgaggacgaacgcgcccccacccccttttatagccccccttc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7nvt Structures of mammalian RNA polymerase II pre-initiation complexes.
Resolution2.9 Å
Binding residue
(original residue number in PDB)
R344 K346
Binding residue
(residue number reindexed from 1)
R81 K83
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0001091 RNA polymerase II general transcription initiation factor binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
GO:0017025 TBP-class protein binding
GO:0046982 protein heterodimerization activity
GO:0061629 RNA polymerase II-specific DNA-binding transcription factor binding
Biological Process
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005669 transcription factor TFIID complex
GO:0005672 transcription factor TFIIA complex
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0097550 transcription preinitiation complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7nvt, PDBe:7nvt, PDBj:7nvt
PDBsum7nvt
PubMed33902107
UniProtP52655|TF2AA_HUMAN Transcription initiation factor IIA subunit 1 (Gene Name=GTF2A1)

[Back to BioLiP]