Structure of PDB 7m4v Chain U Binding Site BS01

Receptor Information

>7m4v Chain U (length=97) Species: 480119 (Acinetobacter baumannii AB0057)

ANFVLNAQARAEDKQGKGASRRLRRESLVPAIIYGGNAEPVAVTLELREL
VKALESNVFFEEVVEIKVGDKVENVKIQALQRHPAKNTPMHADFKRA

Ligand information

>7m4v Chain B (length=115)

gcuggcgaccauagcaagagugaaccaccugaucccuucccgaacucaga
agugaaaccucuuagcgcugaugguagugugggauuacccaugugagagu
aagucaucgccagcu

<<<<<<<<.....<<<<<<<.....<<<<<<...............>>>.
.>>>....>>>>>.>><<<.......<<<<<<<....>>>>>>>......
.>>>..>>>>>>>>.

Receptor-Ligand Complex Structure

Structure summary

• PDB: 7m4v Cryo-EM Determination of Eravacycline-Bound Structures of the Ribosome and the Multidrug Efflux Pump AdeJ of Acinetobacter baumannii.
• Resolution: 2.54 Å
• Binding residue (original residue number in PDB): R11 Q16 K18 R22 R23 R25 R26 I33 Y35 P41 Q79 Q82 H92
• Binding residue (residue number reindexed from 1): R10 Q15 K17 R21 R22 R24 R25 I32 Y34 P40 Q78 Q81 H91

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008097 5S rRNA binding
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7m4v, PDBe:7m4v, PDBj:7m4v
• PDBsum: 7m4v
• PubMed: 34044590
• UniProt: B7I7B6|RL25_ACIB5 Large ribosomal subunit protein bL25 (Gene Name=rplY)