Structure of PDB 7k63 Chain U Binding Site BS01

Receptor Information
>7k63 Chain U (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSI
KALVQNDTLLQVKGTGANGSFKLNRK
Ligand information
>7k63 Chain I (length=197) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggctggaccctatacgcggccgccctggagaatcccggtgccgaggccg
ctcaattggtcgtagacagctctagcaccgcttaaacgcacgtacgcgct
gtcccccgcgttttaaccgccaaggggattactccctagtctccaggcac
gtgtcagatatatacatcctgtgcatgtattgaacagcgaccacccc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7k63 Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
Resolution3.03 Å
Binding residue
(original residue number in PDB)		Q43 Y47 S65 K68 Y87 A94 K105 S112
Binding residue
(residue number reindexed from 1)		Q1 Y5 S23 K26 Y45 A52 K63 S70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7k63, PDBe:7k63, PDBj:7k63
PDBsum7k63
PubMed33238161
UniProtP10412|H14_HUMAN Histone H1.4 (Gene Name=H1-4);
Q92522|H1X_HUMAN Histone H1.10 (Gene Name=H1-10)

[Back to BioLiP]