Structure of PDB 7k60 Chain U Binding Site BS01

Receptor Information

>7k60 Chain U (length=76) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

QPGKYSQLVVETIRRLGERNGSSLAKIYTEAKKVPWFDQQNGRTYLKYSI
KALVQNDTLLQVKGTGANGSFKLNRK

Ligand information

>7k60 Chain I (length=197) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gggctggaccctatacgcggccgccctggagaatcccggtgccgaggccg
ctcaattggtcgtagacagctctagcaccgcttaaacgcacgtacgcgct
gtcccccgcgttttaaccgccaaggggattactccctagtctccaggcac
gtgtcagatatatacatcctgtgcatgtattgaacagcgaccacccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	7k60 Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
Resolution	3.12 Å
Binding residue (original residue number in PDB)	P44 G45 K46 Y47 S48 S65 Y87 K105 G111 S112
Binding residue (residue number reindexed from 1)	P2 G3 K4 Y5 S6 S23 Y45 K63 G69 S70

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003690	double-stranded DNA binding
GO:0003723	RNA binding
GO:0030527	structural constituent of chromatin
GO:0031492	nucleosomal DNA binding
GO:0045296	cadherin binding

	Biological Process
GO:0006334	nucleosome assembly
GO:0030261	chromosome condensation
GO:0045910	negative regulation of DNA recombination

	Cellular Component
GO:0000786	nucleosome
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005730	nucleolus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7k60, PDBe:7k60, PDBj:7k60
PDBsum	7k60
PubMed	33238161
UniProt	Q92522\|H1X_HUMAN Histone H1.10 (Gene Name=H1-10)

[Back to BioLiP]