Structure of PDB 5xs0 Chain U Binding Site BS01

Receptor Information

>5xs0 Chain U (length=184) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

CFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINL
ANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDV
GYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRS
LNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSC

Ligand information

>5xs0 Chain X (length=8) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cccccccc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5xs0 Structural Basis of Homology-Directed DNA Repair Mediated by RAD52
Resolution	3.0 Å
Binding residue (original residue number in PDB)	G58 G59 K102 Y104 E130 G131 K133 S134 L137
Binding residue (residue number reindexed from 1)	G34 G35 K78 Y80 E106 G107 K109 S110 L113
Binding affinity	PDBbind-CN: Kd=5.6nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0000724	double-strand break repair via homologous recombination
GO:0000730	DNA recombinase assembly
GO:0006281	DNA repair
GO:0006310	DNA recombination
GO:0045002	double-strand break repair via single-strand annealing

	Cellular Component
GO:0005634	nucleus

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5xs0, PDBe:5xs0, PDBj:5xs0
PDBsum	5xs0
PubMed	30428330
UniProt	P43351\|RAD52_HUMAN DNA repair protein RAD52 homolog (Gene Name=RAD52)

[Back to BioLiP]