Structure of PDB 5wxf Chain U Binding Site BS01

Receptor Information
>5wxf Chain U (length=246) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFID
YPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIAL
LKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLY
PEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGG
PLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Ligand information
>5wxf Chain P (length=12) Species: 279974 (Phage display vector pTDisp) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
CSWRGLENHAAC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5wxf Cleavage of peptidic inhibitors by target protease is caused by peptide conformational transition.
Resolution1.46 Å
Binding residue
(original residue number in PDB)		R35 V41 H57 C58 I60 D60A Y60B Y64 H99 D189 S190 C191 Q192 G193 S195 V213 W215 R217 G219 G226
Binding residue
(residue number reindexed from 1)		R20 V30 H46 C47 I49 D50 Y51 Y57 H94 D192 S193 C194 Q195 G196 S198 V216 W218 R220 G221 G229
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 Q192 G193 D194 S195 G196
Catalytic site (residue number reindexed from 1) H46 D97 Q195 G196 D197 S198 G199
Enzyme Commision number 3.4.21.73: u-plasminogen activator.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5wxf, PDBe:5wxf, PDBj:5wxf
PDBsum5wxf
PubMed29959058
UniProtP00749|UROK_HUMAN Urokinase-type plasminogen activator (Gene Name=PLAU)

[Back to BioLiP]