Structure of PDB 5sva Chain U Binding Site BS01

Receptor Information

>5sva Chain U (length=156) Species: 4932 (Saccharomyces cerevisiae)

SLYPPPPPYVKFFTQSNLEKLPKYKEKKAAEEITCALDYLIPPPMPKNQQ
YRAFGSIWESTNYQYKIQELRKLLKSLLLNYLELIGVLSINPDMYERKVE
NIRTILVNIHHLLNEYRPHQSRESLIMLLEEQLEYKRGEIREIEQVCKQV
HDKLTS

Ligand information

>5sva Chain k (length=25) Species: 4932 (Saccharomyces cerevisiae)

PSYSPTSPSYSPTSPSYSPTSPSYS

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5sva Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
• Resolution: 15.3 Å
• Binding residue (original residue number in PDB): F23 T24 Q25 S26
• Binding residue (residue number reindexed from 1): F13 T14 Q15 S16

Gene Ontology

Molecular Function

• GO:0003712 transcription coregulator activity
• GO:0003713 transcription coactivator activity
• GO:0005515 protein binding

Biological Process

• GO:0000122 negative regulation of transcription by RNA polymerase II
• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0032968 positive regulation of transcription elongation by RNA polymerase II
• GO:0045944 positive regulation of transcription by RNA polymerase II
• GO:0051123 RNA polymerase II preinitiation complex assembly
• GO:0060261 positive regulation of transcription initiation by RNA polymerase II

Cellular Component

• GO:0005634 nucleus
• GO:0016592 mediator complex
• GO:0070847 core mediator complex

External links

• PDB: RCSB:5sva, PDBe:5sva, PDBj:5sva
• PDBsum: 5sva
• PubMed: 27610567
• UniProt: Q08278|MED7_YEAST Mediator of RNA polymerase II transcription subunit 7 (Gene Name=MED7)