Structure of PDB 5nrl Chain U Binding Site BS01

Receptor Information
>5nrl Chain U (length=196) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LSKGENVPYTFQDEQVRSNPYIYKNHSGKLVCKLCNTMHMSWSSVERHLG
GKKHGLNVLRRGISIEKSSDFRQQQKIIEAKQSLKNNGTIPGSVGLAIQV
NYSSEVKENSVDSDDKAKVPPLIRIVSGLELSDTKQKGKKFLVIAYEPFE
NIAIELPPNEILFSENNDMDNNNDGVDELNKKCTFWDAISKLYYVQ
Ligand information
>5nrl Chain 2 (length=155) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaaucucuuugaaguguaguaucuguucuuuucaguguaacaacugaaau
gaccuaggcucauacacauuuuuuggcaggacgggaagaggagacgucgc
gacccucgcacgagucguucuugacuuggucgcuugauguuucuucuucc
cguuc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5nrl Structure of a pre-catalytic spliceosome.
Resolution7.2 Å
Binding residue
(original residue number in PDB)		T73 M74 H75 S80 R83 H84 G87 K88 K89
Binding residue
(residue number reindexed from 1)		T37 M38 H39 S44 R47 H48 G51 K52 K53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
Biological Process
GO:0000245 spliceosomal complex assembly
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:1903241 U2-type prespliceosome assembly
Cellular Component
GO:0005634 nucleus
GO:0005681 spliceosomal complex
GO:0005686 U2 snRNP
GO:0071004 U2-type prespliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5nrl, PDBe:5nrl, PDBj:5nrl
PDBsum5nrl
PubMed28530653
UniProtQ07350|PRP11_YEAST Pre-mRNA-splicing factor PRP11 (Gene Name=PRP11)

[Back to BioLiP]