Structure of PDB 5mub Chain U Binding Site BS01

Receptor Information

>5mub Chain U (length=218) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

EVKLEESGGGLVQPGGSMKLSCAASGFTFSDAWMDWVRQSPEKGLEWVAE
IRNKVNNHATNYAESVKGRFTISRDDSRSVVYLQMNNLKPEDTGIYYCTG
LTFDYWGQGTTLTVSSAKTTAPSVYPLAPVCGGTTGSSVTLGCLVKGYFP
EPVTLTWNSGSLSSGVHTFPALLLSGLYTLSSSVTVTSNTWPSQTITCNV
AHPASSTKVDKKIEPRGP

Ligand information

>5mub Chain W (length=9) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GARGLTGRP

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5mub Anti-citrullinated protein antibodies cause arthritis by cross-reactivity to joint cartilage.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	D31 W33 L101 T102 F103 D104
Binding residue (residue number reindexed from 1)	D31 W33 L101 T102 F103 D104

External links

PDB	RCSB:5mub, PDBe:5mub, PDBj:5mub
PDBsum	5mub
PubMed	28679953

[Back to BioLiP]