Structure of PDB 5iyc Chain U Binding Site BS01

Receptor Information

>5iyc Chain U (length=170) Species: 9606 (Homo sapiens)

RAPSTSDSVRLKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQEIR
NTDMKYKNRVRSRISNLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASD
ELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSA
DEPMTTFVVCNECGNRWKFC

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 5iyc Chain U Residue 401

Receptor-Ligand Complex Structure

Structure summary

• PDB: 5iyc Near-atomic resolution visualization of human transcription promoter opening.
• Resolution: 3.9 Å
• Binding residue (original residue number in PDB): C263 C294
• Binding residue (residue number reindexed from 1): C132 C163
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006351 DNA-templated transcription
• GO:0006366 transcription by RNA polymerase II
• GO:0006368 transcription elongation by RNA polymerase II
• GO:0045944 positive regulation of transcription by RNA polymerase II

Cellular Component

• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005669 transcription factor TFIID complex
• GO:0005730 nucleolus

External links

• PDB: RCSB:5iyc, PDBe:5iyc, PDBj:5iyc
• PDBsum: 5iyc
• PubMed: 27193682
• UniProt: P23193|TCEA1_HUMAN Transcription elongation factor A protein 1 (Gene Name=TCEA1)