Structure of PDB 5fz5 Chain U Binding Site BS01

Receptor Information
>5fz5 Chain U (length=92) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SNAEASRVYEIIVESVVNEVREDFENAGIDEQTLQDLKNIWQKKLTENLM
LCLYDKVTRTKARWKCSLKDGVVTINRNDYTFQKAQVEAEWV
Ligand information
>5fz5 Chain T (length=56) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acatcggaggtgaatcgaacgttccatagctattatatacacagcgtgct
actgtt
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5fz5 Transcription Initiation Complex Structures Elucidate DNA Opening
Resolution8.8 Å
Binding residue
(original residue number in PDB)		R253 K255
Binding residue
(residue number reindexed from 1)		R59 K61
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000979 RNA polymerase II core promoter sequence-specific DNA binding
GO:0003712 transcription coregulator activity
GO:0005515 protein binding
GO:0017025 TBP-class protein binding
Biological Process
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0060261 positive regulation of transcription initiation by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005672 transcription factor TFIIA complex
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5fz5, PDBe:5fz5, PDBj:5fz5
PDBsum5fz5
PubMed27193681
UniProtP32773|TOA1_YEAST Transcription initiation factor IIA large subunit (Gene Name=TOA1)

[Back to BioLiP]