Structure of PDB 4zkn Chain U Binding Site BS01

Receptor Information

>4zkn Chain U (length=245) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFID
YPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADLAHHNDIALL
KIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYP
EQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGP
LVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK

Ligand information

>4zkn Chain P (length=12) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CSARGLENHRMC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4zkn The crystal structure of mupain-1-IG in complex with murinised human uPA at pH7.4
Resolution	1.36 Å
Binding residue (original residue number in PDB)	R35 H57 C58 D60A Y60B H99 D189 S190 C191 Q192 G193 S195 W215 G219
Binding residue (residue number reindexed from 1)	R20 H46 C47 D50 Y51 H93 D191 S192 C193 Q194 G195 S197 W217 G220

Enzymatic activity

Enzyme Commision number

3.4.21.73: u-plasminogen activator.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4zkn, PDBe:4zkn, PDBj:4zkn
PDBsum	4zkn
PubMed
UniProt	P00749\|UROK_HUMAN Urokinase-type plasminogen activator (Gene Name=PLAU)

[Back to BioLiP]