Structure of PDB 4x1r Chain U Binding Site BS01

Receptor Information

>4x1r Chain U (length=247) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFID
YPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIAL
LKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLY
PEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGG
PLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE

Ligand information

>4x1r Chain P (length=10) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CPAYSAYLDC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4x1r A cyclic peptidic serine protease inhibitor: increasing affinity by increasing peptide flexibility.
Resolution	2.1 Å
Binding residue (original residue number in PDB)	R35 C42 H57 C58 D97 T97A L97B Y99 Y151 Q192 W215 G216 R217
Binding residue (residue number reindexed from 1)	R20 C31 H46 C47 D90 T91 L92 Y94 Y150 Q195 W218 G219 R220

Enzymatic activity

Enzyme Commision number

3.4.21.73: u-plasminogen activator.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:4x1r, PDBe:4x1r, PDBj:4x1r
PDBsum	4x1r
PubMed	25545505
UniProt	P00749\|UROK_HUMAN Urokinase-type plasminogen activator (Gene Name=PLAU)

[Back to BioLiP]