Structure of PDB 4x1q Chain U Binding Site BS01

Receptor Information
>4x1q Chain U (length=247) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFID
YPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAYHNDIAL
LKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLY
PEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGG
PLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4x1q A cyclic peptidic serine protease inhibitor: increasing affinity by increasing peptide flexibility.
Resolution2.28 Å
Binding residue
(original residue number in PDB)		R35 Y40 V41 C42 H57 C58 D97 T97A L97B Y99 Y151 D189 S190 Q192 S195 W215 G216 R217 G219
Binding residue
(residue number reindexed from 1)		R20 Y29 V30 C31 H46 C47 D90 T91 L92 Y94 Y150 D192 S193 Q195 S198 W218 G219 R220 G221
Enzymatic activity
Enzyme Commision number 3.4.21.73: u-plasminogen activator.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:4x1q, PDBe:4x1q, PDBj:4x1q
PDBsum4x1q
PubMed25545505
UniProtP00749|UROK_HUMAN Urokinase-type plasminogen activator (Gene Name=PLAU)

[Back to BioLiP]