Structure of PDB 4qlc Chain U Binding Site BS01

Receptor Information
>4qlc Chain U (length=76) Species: 9031 (Gallus gallus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SASHPTYSEMIAAAIRAEKSRGGSSRQSIQKYIKSHYKVGHNADLQIKLS
IRRLLAAGVLKQTKGVGASGSFRLAK
Ligand information
>4qlc Chain I (length=166) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
actggccgccctggagaatcccggtgccgaggccgctcaattggtcgtag
acagctctagcaccgcttaaacgcacgtacgcgctgtcccccgcgtttta
accgccaaggggattactccctagtctccaggcacgtgtcagatatatac
atcctgtgcatgtaag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4qlc Structural Mechanisms of Nucleosome Recognition by Linker Histones.
Resolution3.503 Å
Binding residue
(original residue number in PDB)		H25 T27 Y28 R42 S46 Q48 R74 K85 G91 S92
Binding residue
(residue number reindexed from 1)		H4 T6 Y7 R21 S25 Q27 R53 K64 G70 S71
Binding affinityPDBbind-CN: Kd=0.35uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4qlc, PDBe:4qlc, PDBj:4qlc
PDBsum4qlc
PubMed26212454
UniProtP02259|H5_CHICK Histone H5

[Back to BioLiP]