Structure of PDB 4ne1 Chain U Binding Site BS01

Receptor Information
>4ne1 Chain U (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGFRKELVSRLLHLHFKDDKTKVSGDALQLMVELLKVFVVEAAVRGVRQA
QAEDALRVDVDQLEKVLPQLLLDF
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ne1 The MHF complex senses branched DNA by binding a pair of crossover DNA duplexes.
Resolution6.499 Å
Binding residue
(original residue number in PDB)		R17 H20 K29 V30 S31 G32
Binding residue
(residue number reindexed from 1)		R10 H13 K22 V23 S24 G25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0005515 protein binding
Biological Process
GO:0000712 resolution of meiotic recombination intermediates
GO:0006281 DNA repair
GO:0007059 chromosome segregation
GO:0031297 replication fork processing
GO:0031398 positive regulation of protein ubiquitination
GO:0036297 interstrand cross-link repair
GO:0051301 cell division
GO:0051382 kinetochore assembly
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000785 chromatin
GO:0000939 inner kinetochore
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0043240 Fanconi anaemia nuclear complex
GO:0071821 FANCM-MHF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ne1, PDBe:4ne1, PDBj:4ne1
PDBsum4ne1
PubMed24390579
UniProtA8MT69|CENPX_HUMAN Centromere protein X (Gene Name=CENPX)

[Back to BioLiP]