Structure of PDB 3oy5 Chain U Binding Site BS01

Receptor Information

>3oy5 Chain U (length=246) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFID
YPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSATLAHHNDIALL
KIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYP
EQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGP
LVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE

Ligand information

>3oy5 Chain P (length=15) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DGACSWRGLENHAMC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3oy5 The binding mechanism of a peptidic cyclic serine protease inhibitor
Resolution	2.31 Å
Binding residue (original residue number in PDB)	R35 H57 C58 D60A Y60B H99 S146 D189 S190 C191 Q192 G193 S195 S214 W215 G219 K243 E244
Binding residue (residue number reindexed from 1)	R20 H46 C47 D50 Y51 H93 S144 D191 S192 C193 Q194 G195 S197 S216 W217 G220 K245 E246

Enzymatic activity

Enzyme Commision number

3.4.21.73: u-plasminogen activator.

Gene Ontology

	Molecular Function
GO:0004252	serine-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:3oy5, PDBe:3oy5, PDBj:3oy5
PDBsum	3oy5
PubMed	21802428
UniProt	P00749\|UROK_HUMAN Urokinase-type plasminogen activator (Gene Name=PLAU)

[Back to BioLiP]