Structure of PDB 1pp7 Chain U Binding Site BS01

Receptor Information
>1pp7 Chain U (length=114) Species: 5722 (Trichomonas vaginalis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DLEASFTSRLPPEIVAALKRKSSRDPNSRFPRKLHMLLTYLASNPQLEEE
IGLSWISDTEFKMKKKNVALVMGIKLNTLNVNLRDLAFEQLQHDKGGWTQ
WKRSGFTRNSVFED
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1pp7 Structural Basis of Core Promoter Recognition in a Primitive Eukaryote
Resolution2.45 Å
Binding residue
(original residue number in PDB)		S26 S27 R28 R33 F34 I78 K79 N81 T82 N86
Binding residue
(residue number reindexed from 1)		S22 S23 R24 R29 F30 I74 K75 N77 T78 N82
Enzymatic activity
Enzyme Commision number ?
External links