Structure of PDB 8x19 Chain T Binding Site BS01

Receptor Information
>8x19 Chain T (length=403) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DEVGALVFDIGSYTVRAGYAGEDCPKVDFPTAIGMVVEGPTYYIDTNALR
VPRENMEAISPLKNGMVEDWDSFQAILDHTYKMHVKSEASLHPVLMSEAP
WNTRAKREKLTELMFEHYNIPAFFLCKTAVLTAFANGRSTGLILDSGATH
TTAIPVHDGYVLQQGIVKSPLAGDFITMQCRELFQEMNIELVPPYMIASK
EAVREGSPANWKRKEKLPQVTRSWHNYMCNCVIQDFQASVLQVSDSTYDE
QVAAQMPTVHYEFPNGYNCDFGAERLKIPEGLFDPSNVKGLSGNTMLGVS
HVVTTSVGMCDIDIRPGLYGSVIVAGGNTLIQSFTDRLNRELSQKTPPSM
RLKLIANNTTVERRFSSWIGGSILASLGTFQQMWISKQEYEEGGKQCVER
KCP
Ligand information
Ligand IDATP
InChIInChI=1S/C10H16N5O13P3/c11-8-5-9(13-2-12-8)15(3-14-5)10-7(17)6(16)4(26-10)1-25-30(21,22)28-31(23,24)27-29(18,19)20/h2-4,6-7,10,16-17H,1H2,(H,21,22)(H,23,24)(H2,11,12,13)(H2,18,19,20)/t4-,6-,7-,10-/m1/s1
InChIKeyZKHQWZAMYRWXGA-KQYNXXCUSA-N
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.5.0c1nc(c2c(n1)n(cn2)C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O)N
CACTVS 3.341Nc1ncnc2n(cnc12)[CH]3O[CH](CO[P](O)(=O)O[P](O)(=O)O[P](O)(O)=O)[CH](O)[CH]3O
ACDLabs 10.04O=P(O)(O)OP(=O)(O)OP(=O)(O)OCC3OC(n2cnc1c(ncnc12)N)C(O)C3O
OpenEye OEToolkits 1.5.0c1nc(c2c(n1)n(cn2)[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@@](=O)(O)O[P@](=O)(O)OP(=O)(O)O)O)O)N
CACTVS 3.341Nc1ncnc2n(cnc12)[C@@H]3O[C@H](CO[P@](O)(=O)O[P@@](O)(=O)O[P](O)(O)=O)[C@@H](O)[C@H]3O
FormulaC10 H16 N5 O13 P3
NameADENOSINE-5'-TRIPHOSPHATE
ChEMBLCHEMBL14249
DrugBankDB00171
ZINCZINC000004261765
PDB chain8x19 Chain T Residue 501 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8x19 Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state
Resolution3.2 Å
Binding residue
(original residue number in PDB)		G19 S20 Y21 R24 G173 Q263 A264 G352 G353 N354 L356 R390
Binding residue
(residue number reindexed from 1)		G11 S12 Y13 R16 G147 Q237 A238 G326 G327 N328 L330 R364
Annotation score4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003682 chromatin binding
GO:0003713 transcription coactivator activity
GO:0005515 protein binding
GO:0031492 nucleosomal DNA binding
Biological Process
GO:0000723 telomere maintenance
GO:0001825 blastocyst formation
GO:0003407 neural retina development
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006282 regulation of DNA repair
GO:0006310 DNA recombination
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II
GO:0007165 signal transduction
GO:0007399 nervous system development
GO:0008284 positive regulation of cell population proliferation
GO:0021510 spinal cord development
GO:0030071 regulation of mitotic metaphase/anaphase transition
GO:0033044 regulation of chromosome organization
GO:0042981 regulation of apoptotic process
GO:0045582 positive regulation of T cell differentiation
GO:0045596 negative regulation of cell differentiation
GO:0045597 positive regulation of cell differentiation
GO:0045663 positive regulation of myoblast differentiation
GO:0045739 positive regulation of DNA repair
GO:0045893 positive regulation of DNA-templated transcription
GO:0045995 regulation of embryonic development
GO:0051726 regulation of cell cycle
GO:0060382 regulation of DNA strand elongation
GO:0070316 regulation of G0 to G1 transition
GO:1902459 positive regulation of stem cell population maintenance
GO:1904507 positive regulation of telomere maintenance in response to DNA damage
GO:1905168 positive regulation of double-strand break repair via homologous recombination
GO:2000045 regulation of G1/S transition of mitotic cell cycle
GO:2000779 regulation of double-strand break repair
GO:2000781 positive regulation of double-strand break repair
GO:2000819 regulation of nucleotide-excision repair
Cellular Component
GO:0000776 kinetochore
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005886 plasma membrane
GO:0016363 nuclear matrix
GO:0016514 SWI/SNF complex
GO:0016586 RSC-type complex
GO:0031011 Ino80 complex
GO:0032991 protein-containing complex
GO:0035060 brahma complex
GO:0035267 NuA4 histone acetyltransferase complex
GO:0071564 npBAF complex
GO:0140288 GBAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8x19, PDBe:8x19, PDBj:8x19
PDBsum8x19
PubMed38331872
UniProtO96019|ACL6A_HUMAN Actin-like protein 6A (Gene Name=ACTL6A)

[Back to BioLiP]