Structure of PDB 8ovc Chain T Binding Site BS01

Receptor Information
>8ovc Chain T (length=139) Species: 1772 (Mycolicibacterium smegmatis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MHIEARLFEILTAFFALAAVVYAVLTAMFATGGVEWAGTTALVLTTGLTL
ITGTFFRFVARRLDTRPEDYEDAEISDGAGELGFFAPHSWWPILISLSFS
TAAVGAALWLPWLIAAGVAFVITSVCGLVFEYYWGPEKH
Ligand information
>8ovc Chain F (length=23) Species: 1772 (Mycolicibacterium smegmatis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
AAAAAAAAAAAAAAAAAAAAAAA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ovc Long-range charge transfer mechanism of the III 2 IV 2 mycobacterial supercomplex.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		R62 L82 G83 F84 F85
Binding residue
(residue number reindexed from 1)		R62 L82 G83 F84 F85
Gene Ontology
Molecular Function
GO:0004129 cytochrome-c oxidase activity
GO:0016491 oxidoreductase activity
Biological Process
GO:1902600 proton transmembrane transport
Cellular Component
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ovc, PDBe:8ovc, PDBj:8ovc
PDBsum8ovc
PubMed38902248
UniProtA0R056

[Back to BioLiP]