Structure of PDB 7r5s Chain T Binding Site BS01

Receptor Information
>7r5s Chain T (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPRQDPHKAGLSHYVKLFSFYAKMPMERKALEMVEKCLDKYFQHLCDDLE
VFAAHAGRKTVKPEDLELLMRRQGLVTDQVSLHVLVERHLPLEYRQLLIP
CAYSGNSVFPAQ
Ligand information
>7r5s Chain J (length=41) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agtggatatttggaccgctttgaggccttcgttggaaacgg
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7r5s Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
Resolution2.83 Å
Binding residue
(original residue number in PDB)		P451 Q453
Binding residue
(residue number reindexed from 1)		P2 Q4
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0000278 mitotic cell cycle
GO:0007059 chromosome segregation
GO:0051276 chromosome organization
GO:0051301 cell division
GO:0051382 kinetochore assembly
Cellular Component
GO:0000775 chromosome, centromeric region
GO:0000776 kinetochore
GO:0000939 inner kinetochore
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005829 cytosol
GO:0016604 nuclear body

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r5s, PDBe:7r5s, PDBj:7r5s
PDBsum7r5s
PubMed35420891
UniProtQ96BT3|CENPT_HUMAN Centromere protein T (Gene Name=CENPT)

[Back to BioLiP]