Structure of PDB 7md5 Chain T Binding Site BS01

Receptor Information
>7md5 Chain T (length=30) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Ligand information
>7md5 Chain S (length=21) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GIVEQCCTSICSLYQLENYCN
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7md5 Functionally selective signaling and broad metabolic benefits by novel insulin receptor partial agonists.
Resolution5.2 Å
Binding residue
(original residue number in PDB)		F1801 N1803 Q1804 H1805 L1811 V1818 C1819 R1822 G1823 F1824 F1825
Binding residue
(residue number reindexed from 1)		F1 N3 Q4 H5 L11 V18 C19 R22 G23 F24 F25
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005179 hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:7md5, PDBe:7md5, PDBj:7md5
PDBsum7md5
PubMed35177603
UniProtP01308|INS_HUMAN Insulin (Gene Name=INS)

[Back to BioLiP]