Structure of PDB 7b5m Chain T Binding Site BS01

Receptor Information
>7b5m Chain T (length=325) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSWDSLPDELLLGIFSCLCLPELLKVSGVCKRWYRLASDESLWQTLDLTG
KNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIE
VSTLHGILSQCSKLQNLSLEGLRLSDPIVNTLAKNSNLVRLNLSGCSGFS
EFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYR
KNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEFFQLNYLQHLSLSR
CYDIIPETLLELGEIPTLKTLQVFGIVPDGTLQLLKEALPHLQINCSHFT
TIARPTIGNKKNQEIWGIKCRLTLQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7b5m Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
Resolution3.91 Å
Binding residue
(original residue number in PDB)		R294 D319 R344 Y346
Binding residue
(residue number reindexed from 1)		R200 D225 R250 Y252
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0042802 identical protein binding
GO:1990756 ubiquitin-like ligase-substrate adaptor activity
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0000086 G2/M transition of mitotic cell cycle
GO:0000209 protein polyubiquitination
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0016567 protein ubiquitination
GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0033148 positive regulation of intracellular estrogen receptor signaling pathway
GO:0042981 regulation of apoptotic process
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045087 innate immune response
GO:0051607 defense response to virus
GO:0051726 regulation of cell cycle
GO:0070534 protein K63-linked ubiquitination
GO:0070936 protein K48-linked ubiquitination
GO:1902916 positive regulation of protein polyubiquitination
GO:1905168 positive regulation of double-strand break repair via homologous recombination
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0019005 SCF ubiquitin ligase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7b5m, PDBe:7b5m, PDBj:7b5m
PDBsum7b5m
PubMed33536622
UniProtQ13309|SKP2_HUMAN S-phase kinase-associated protein 2 (Gene Name=SKP2)

[Back to BioLiP]