Structure of PDB 7asn Chain T Binding Site BS01

Receptor Information
>7asn Chain T (length=94) Species: 1280 (Staphylococcus aureus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ASLKSIIRQGKQTRSDLKQLRKSGKVPAVVYGYGTKNVSVKVDEVEFIKV
IREVGRNGVIELGVGSKTIKVMVADYQFDPLKNQITHIDFLAIN
Ligand information
>7asn Chain B (length=106) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggugacagcaaggaggucacaccuguucccauccgaacacagaaguuaag
cuccuuagcgucgaugguaucgaacuuaguuccgcuagaguagaacguug
ccaggc
<<<.<<.<<<<<<<......<<<<<..............>>>..>>....
.>>>>>.>>.<<.......<.<<<<...>>>>.>........>>..>>.>
>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7asn Staphylococcus aureus 50S after 30 minutes incubation a 37C
Resolution2.73 Å
Binding residue
(original residue number in PDB)		R9 R15 S16 K19 Y32 N38 H88
Binding residue
(residue number reindexed from 1)		R8 R14 S15 K18 Y31 N37 H87
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7asn, PDBe:7asn, PDBj:7asn
PDBsum7asn
PubMed
UniProtQ2FJE0|RL25_STAA3 Large ribosomal subunit protein bL25 (Gene Name=rplY)

[Back to BioLiP]