Structure of PDB 7ase Chain T Binding Site BS01

Receptor Information
>7ase Chain T (length=132) Species: 5693 (Trypanosoma cruzi) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFTYRGLEIDPLLALSEEEFKTLVHARARRHMNRHANRRAPVLLKRLREA
KKDVKAGEKPRAVKTHLRDVVITPEMVGSVVGIYNGRQFNAVEIKGEMIG
HYLGEFSMTYKPVIHGRPGVGATHSSRFIPLK
Ligand information
>7ase Chain 1 (length=75) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agcaccguggcgcaguggaagcgcgaugggcucauaacccauaggacguu
ggaucgaaaccaaccggugcuacca
<<<<<<<..<<<<.......>>>>.<<<<<.......>>>>>.....<<<
<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ase Structural Differences in Translation Initiation between Pathogenic Trypanosomatids and Their Mammalian Hosts.
Resolution3.33 Å
Binding residue
(original residue number in PDB)		T143 H144 S145
Binding residue
(residue number reindexed from 1)		T123 H124 S125
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ase, PDBe:7ase, PDBj:7ase
PDBsum7ase
PubMed33357443
UniProtQ4DGZ5

[Back to BioLiP]