Structure of PDB 6z7n Chain T Binding Site BS01

Receptor Information
>6z7n Chain T (length=178) Species: 10524 (Human adenovirus 41) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SKEIPTPYMWSYQPQMGLAAGASQDYSSRMNWLSAGPHMIGRVNGIRATR
NQILLEQAALTSTPRSQLNPPNWPAAQVYQENPAPTTVLLPRDAEAEVQM
TNSGAQLAGRSSFTPRQAYLTLQSSSSQPRSGGIGTLQFVEEFVPSVYFN
PFSGAPGLYPDDFIPNYDAVSESVDGYD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6z7n The structure of enteric human adenovirus 41-A leading cause of diarrhea in children.
Resolution3.77 Å
Binding residue
(original residue number in PDB)		Q172 Y174 T176 L177
Binding residue
(residue number reindexed from 1)		Q117 Y119 T121 L122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0019028 viral capsid
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:6z7n, PDBe:6z7n, PDBj:6z7n
PDBsum6z7n
PubMed33523995
UniProtP11822|CAP8_ADE41 Pre-hexon-linking protein VIII (Gene Name=L4)

[Back to BioLiP]