Structure of PDB 6ttu Chain T Binding Site BS01

Receptor Information

>6ttu Chain T (length=394) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DFITALPARGLDHIAENILSYLDAKSLCAAELVCKEWYRVTSDGMLWKKL
IERMVRTDSLWRGLAERRGWGQYLFPPNSFYRALYPKIIQDIETIESNWR
CGRHSLQRIHCRSEKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRIL
TGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHL
RFNNGMMVTCSKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYI
VSASGDRTIKVWNTSTCEFVRTLNGHKRGIACLQYRDRLVVSGSSDNTIR
LWDIECGACLRVLEGHEELVRCIRFDNKRIVSGAYDGKIKVWDLVAALDP
RAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILIWDFL

Ligand information

>6ttu Chain I (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CKKERHDSG

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	6ttu NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
Resolution	3.7 Å
Binding residue (original residue number in PDB)	Y307 R321 S345 L347 L387 R557
Binding residue (residue number reindexed from 1)	Y118 R132 S156 L158 L198 R368

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008013	beta-catenin binding
GO:0016874	ligase activity
GO:0045309	protein phosphorylated amino acid binding
GO:0046983	protein dimerization activity
GO:0061630	ubiquitin protein ligase activity
GO:1990756	ubiquitin-like ligase-substrate adaptor activity
GO:1990757	ubiquitin ligase activator activity

	Biological Process
GO:0000209	protein polyubiquitination
GO:0006470	protein dephosphorylation
GO:0006511	ubiquitin-dependent protein catabolic process
GO:0007165	signal transduction
GO:0016055	Wnt signaling pathway
GO:0016567	protein ubiquitination
GO:0030163	protein catabolic process
GO:0031146	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0031648	protein destabilization
GO:0033598	mammary gland epithelial cell proliferation
GO:0038061	non-canonical NF-kappaB signal transduction
GO:0042752	regulation of circadian rhythm
GO:0042753	positive regulation of circadian rhythm
GO:0043122	regulation of canonical NF-kappaB signal transduction
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043433	negative regulation of DNA-binding transcription factor activity
GO:0045862	positive regulation of proteolysis
GO:0045879	negative regulation of smoothened signaling pathway
GO:0045892	negative regulation of DNA-templated transcription
GO:0045893	positive regulation of DNA-templated transcription
GO:0048511	rhythmic process
GO:0050860	negative regulation of T cell receptor signaling pathway
GO:0051726	regulation of cell cycle
GO:0060444	branching involved in mammary gland duct morphogenesis
GO:0060828	regulation of canonical Wnt signaling pathway
GO:0061136	regulation of proteasomal protein catabolic process
GO:0070936	protein K48-linked ubiquitination
GO:0071407	cellular response to organic cyclic compound
GO:1904668	positive regulation of ubiquitin protein ligase activity

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0019005	SCF ubiquitin ligase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ttu, PDBe:6ttu, PDBj:6ttu
PDBsum	6ttu
PubMed	32051583
UniProt	Q9Y297\|FBW1A_HUMAN F-box/WD repeat-containing protein 1A (Gene Name=BTRC)

[Back to BioLiP]