Structure of PDB 6tqo Chain T Binding Site BS01

Receptor Information
>6tqo Chain T (length=255) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MHPMLNIAVRAARKAGNLIAKNYETPDANDFVTNVDKAAEAVIIDTIRKS
YPQHTIITEESGELEGTDQDVQWVIDPLDGTTNFIKRLPHFAVSIAVRIK
GRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFP
FKAKQYATTYINIVGKLFNECADFRRTGSAALDLAYVAAGRVDGFFEIGL
RPWDFAAGELLVREAGGIVSDFTGGHNYMLTGNIVAGNPRVVKAMLANMR
DELSD
Ligand information
>6tqo Chain R (length=45) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
acugcucuuuaacaauuuaucagaucuguguggguggcguguggc
.............................................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6tqo Structure-Based Mechanisms of a Molecular RNA Polymerase/Chaperone Machine Required for Ribosome Biosynthesis.
Resolution3.8 Å
Binding residue
(original residue number in PDB)
Q134 R141
Binding residue
(residue number reindexed from 1)
Q126 R133
Enzymatic activity
Enzyme Commision number 3.1.3.25: inositol-phosphate phosphatase.
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0001072 transcription antitermination factor activity, RNA binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008934 inositol monophosphate 1-phosphatase activity
GO:0016787 hydrolase activity
GO:0031403 lithium ion binding
GO:0042134 rRNA primary transcript binding
GO:0046872 metal ion binding
GO:0047954 glycerol-2-phosphatase activity
GO:0052832 inositol monophosphate 3-phosphatase activity
GO:0052833 inositol monophosphate 4-phosphatase activity
Biological Process
GO:0006020 inositol metabolic process
GO:0007165 signal transduction
GO:0031564 transcription antitermination
GO:0042254 ribosome biogenesis
GO:0046854 phosphatidylinositol phosphate biosynthetic process
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6tqo, PDBe:6tqo, PDBj:6tqo
PDBsum6tqo
PubMed32871103
UniProtP0ADG4|SUHB_ECOLI Nus factor SuhB (Gene Name=suhB)

[Back to BioLiP]