Structure of PDB 5vi8 Chain T Binding Site BS01

Receptor Information
>5vi8 Chain T (length=53) Species: 246196 (Mycolicibacterium smegmatis MC2 155) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IDDLDLTVRSYNCLKREGVHTVGELVARTESDLLDIRNFGQKSIDEVKIK
LHQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5vi8 Structural insights into the mycobacteria transcription initiation complex from analysis of X-ray crystal structures.
Resolution2.76 Å
Binding residue
(original residue number in PDB)		V258 R259 N262 N288
Binding residue
(residue number reindexed from 1)		V8 R9 N12 N38
Enzymatic activity
Enzyme Commision number 2.7.7.6: DNA-directed RNA polymerase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
Biological Process
GO:0006351 DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5vi8, PDBe:5vi8, PDBj:5vi8
PDBsum5vi8
PubMed28703128
UniProtA0QSL8|RPOA_MYCS2 DNA-directed RNA polymerase subunit alpha (Gene Name=rpoA)

[Back to BioLiP]