Structure of PDB 5oo6 Chain T Binding Site BS01

Receptor Information

>5oo6 Chain T (length=148) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GLLKALRSDSYVELSQYRDQHFRGDNEEQEKLLKKSCTLYVGNLSFYTTE
EQIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYING
TRLDDRIIRTDWDAGFKEGRQYGRGRSGGQVRDEYRQDYDAGRGGYGK

Ligand information

>5oo6 Chain U (length=11) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DPRAIVEYDFF

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5oo6 Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	F49 Y50 E53 Q55 L73 K78 T79 A80 Y89 D107
Binding residue (residue number reindexed from 1)	F46 Y47 E50 Q52 L70 K75 T76 A77 Y86 D104

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000339	RNA cap binding
GO:0000340	RNA 7-methylguanosine cap binding
GO:0003676	nucleic acid binding
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0005515	protein binding
GO:0017069	snRNA binding

	Biological Process
GO:0000184	nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000380	alternative mRNA splicing, via spliceosome
GO:0000398	mRNA splicing, via spliceosome
GO:0002191	cap-dependent translational initiation
GO:0006397	mRNA processing
GO:0006406	mRNA export from nucleus
GO:0006408	snRNA export from nucleus
GO:0006417	regulation of translation
GO:0006446	regulation of translational initiation
GO:0008334	histone mRNA metabolic process
GO:0008380	RNA splicing
GO:0016071	mRNA metabolic process
GO:0031047	regulatory ncRNA-mediated gene silencing
GO:0031053	primary miRNA processing
GO:0031124	mRNA 3'-end processing
GO:0031442	positive regulation of mRNA 3'-end processing
GO:0032968	positive regulation of transcription elongation by RNA polymerase II
GO:0035194	regulatory ncRNA-mediated post-transcriptional gene silencing
GO:0035195	miRNA-mediated post-transcriptional gene silencing
GO:0042789	mRNA transcription by RNA polymerase II
GO:0045292	mRNA cis splicing, via spliceosome
GO:0046833	positive regulation of RNA export from nucleus
GO:0051028	mRNA transport

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005846	nuclear cap binding complex
GO:0034518	RNA cap binding complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5oo6, PDBe:5oo6, PDBj:5oo6
PDBsum	5oo6
PubMed	29101316
UniProt	P52298\|NCBP2_HUMAN Nuclear cap-binding protein subunit 2 (Gene Name=NCBP2)

[Back to BioLiP]