Structure of PDB 5iy9 Chain T Binding Site BS01

Receptor Information
>5iy9 Chain T (length=222) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AERGELDLTGAKQNTGVWLVKVPKYLSQQWAKASGRGEVGKLRIAKTQGR
TEVSFTLNEDLANEHPFVLQSVGGQTLTVFTESSSDKLSLEGIVVQRAEC
RPAASENYMRLKRLQIEESSKPVRLSQQLDKVVTTNYKPVANHQYNIEYE
RKKKEDGKRARADKQHVLDMLFSAFEKHQYYNLKDLVDITKQPVVYLKEI
LKEIGVQNVKGIHKNTWELKPE
Ligand information
>5iy9 Chain X (length=83) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gaagggcgcctataaaagggggtgggggcgtttttttttttttttttttt
cgaacactcgagccgagcagacgtgcctacgga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5iy9 Near-atomic resolution visualization of human transcription promoter opening.
Resolution6.3 Å
Binding residue
(original residue number in PDB)		R175 R177 P209 G227 I228 H229
Binding residue
(residue number reindexed from 1)		R159 R161 P193 G211 I212 H213
Enzymatic activity
Enzyme Commision number 3.6.4.12: DNA helicase.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0016251 RNA polymerase II general transcription initiation factor activity
Biological Process
GO:0006366 transcription by RNA polymerase II
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0006368 transcription elongation by RNA polymerase II
GO:0045944 positive regulation of transcription by RNA polymerase II
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005674 transcription factor TFIIF complex
GO:0015630 microtubule cytoskeleton

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5iy9, PDBe:5iy9, PDBj:5iy9
PDBsum5iy9
PubMed27193682
UniProtP13984|T2FB_HUMAN General transcription factor IIF subunit 2 (Gene Name=GTF2F2)

[Back to BioLiP]