Structure of PDB 5iro Chain T Binding Site BS01

Receptor Information
>5iro Chain T (length=103) Species: 28280 (Human adenovirus E4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KADPCLTFNPDKCQLSFQPDGNRCAVLIKCGWECQSVAIQYKNKTRNNTL
ASTWQPGDPEWYTVSVPGADGFLRTVNNTFIFEHMCNTAMFMSRQYHMWP
PRK
Ligand information
>5iro Chain V (length=9) Species: 11908 (Human T-cell leukemia virus type I) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LLFGYPVYV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB5iro Structure of the Adenovirus Type 4 (Species E) E3-19K/HLA-A2 Complex Reveals Species-Specific Features in MHC Class I Recognition.
Resolution2.64 Å
Binding residue
(original residue number in PDB)		D8 P9 L11
Binding residue
(residue number reindexed from 1)		D3 P4 L6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005537 D-mannose binding
Biological Process
GO:0019049 virus-mediated perturbation of host defense response

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:5iro, PDBe:5iro, PDBj:5iro
PDBsum5iro
PubMed27385781
UniProtQ8BEL5

[Back to BioLiP]