Structure of PDB 4pjo Chain T Binding Site BS01

Receptor Information
>4pjo Chain T (length=74) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYI
DGALSGHLGEVLIRCNNVLYIRGV
Ligand information
>4pjo Chain 3 (length=47) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggacuuaccuggcagugaggugcacacacugcauaauuugugguagu
...........<<<<<<.........>>>>>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4pjo ?
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K24 W25 G38 Y39 M40 R65 N67
Binding residue
(residue number reindexed from 1)		K23 W24 G37 Y38 M39 R64 N66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000387 spliceosomal snRNP assembly
GO:0000398 mRNA splicing, via spliceosome
Cellular Component
GO:0005681 spliceosomal complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4pjo, PDBe:4pjo, PDBj:4pjo
PDBsum4pjo
PubMed25555158
UniProtP62306|RUXF_HUMAN Small nuclear ribonucleoprotein F (Gene Name=SNRPF)

[Back to BioLiP]