Structure of PDB 3sjv Chain T Binding Site BS01

Receptor Information

>3sjv Chain T (length=241) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AGVTQTPKFRVLKTGQSMTLLCAQDMNHEYMYWYRQDPGMGLRLIHYSVG
EGTTAKGEVPDGYNVSRLKKQNFLLGLESAAPSQTSVYFCASGQGNFDIQ
YFGAGTRLSVLEDLKNVFPPEVAVFEPSEAEISHTQKATLVCLATGFYPD
HVELSWWVNGKEVHSGVCTDPQPLKEQPALNDSRYALSSRLRVSATFWQN
PRNHFRCQVQFYGLSENDEWTQDRAKPVTQIVSAEAWGRAD

Ligand information

>3sjv Chain R (length=9) Species: 10376 (human gammaherpesvirus 4) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

FLRGRAYGL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	3sjv A structural basis for varied alpha-beta TCR usage against an immunodominant EBV antigen restricted to a HLA-B8 molecule.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	Q108 G109 N110 D112
Binding residue (residue number reindexed from 1)	Q94 G95 N96 D98

External links

PDB	RCSB:3sjv, PDBe:3sjv, PDBj:3sjv
PDBsum	3sjv
PubMed	22140258

[Back to BioLiP]