Structure of PDB 2xqn Chain T Binding Site BS01

Receptor Information
>2xqn Chain T (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDK
PVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSK
CLIGQKFMPVEGMVFCSVECKKRMS
Ligand information
>2xqn Chain A (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LQTASLRDGPAKRAVWVRHTSS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2xqn Molecular recognition of the Tes LIM2-3 domains by the actin-related protein Arp7A.
Resolution2.62 Å
Binding residue
(original residue number in PDB)		E312 Y313 T314 Q315 L323 L335 G337 E338 I339 Y340 V341 P370 V372 Q373 R374 T376 G400 K402 F403
Binding residue
(residue number reindexed from 1)		E16 Y17 T18 Q19 L27 L39 G41 E42 I43 Y44 V45 P74 V76 Q77 R78 T80 G104 K106 F107
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:2xqn, PDBe:2xqn, PDBj:2xqn
PDBsum2xqn
PubMed21278383
UniProtQ9UGI8|TES_HUMAN Testin (Gene Name=TES)

[Back to BioLiP]