Structure of PDB 2wss Chain T Binding Site BS01

Receptor Information
>2wss Chain T (length=86) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HYLFDVQRNNIAMALEVTYRERLHRVYREVKNRLDYHISVQNMMRQKEQE
HMINWVEKRVVQSISAQQEKETIAKCIADLKLLSKK
Ligand information
>2wss Chain U (length=28) Species: 9913 (Bos taurus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
LKSWNETLTSRLVDDFEKKFNYTAQVDA
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB2wss The Structure of the Membrane Extrinsic Region of Bovine ATP Synthase
Resolution3.2 Å
Binding residue
(original residue number in PDB)		R129 N131 I132 M134 V151 L155
Binding residue
(residue number reindexed from 1)		R8 N10 I11 M13 V30 L34
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0015078 proton transmembrane transporter activity
Biological Process
GO:0015986 proton motive force-driven ATP synthesis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:2wss, PDBe:2wss, PDBj:2wss
PDBsum2wss
PubMed19995987
UniProtP13619|AT5F1_BOVIN ATP synthase F(0) complex subunit B1, mitochondrial (Gene Name=ATP5PB)

[Back to BioLiP]