Structure of PDB 1dv6 Chain T Binding Site BS01

Receptor Information

>1dv6 Chain T (length=246) Species: 1063 (Cereibacter sphaeroides)

DLASLAIYSFWIFLAGLIYYLQTENMREGYPLENEDGTPAANQGPFPLPK
PKTFILPHGRGTLTVPGPESEDRPIALARTAVSEGFPHAPTGDPMKDGVG
PASWVARRDLPELDGHGHNKIKPMKAAAGFHVSAGKNPIGLPVRGCDLEI
AGKVVDIWVDIPEQMARFLEVELKDGSTRLLPMQMVKVQSNRVHVNALSS
DLFAGIPTIKSPTEVTLLEEDKICGYVAGGLMYAAPKRKSVVAAML

Ligand information

• Ligand ID: ZN
• InChI: InChI=1S/Zn/q+2
• InChIKey: PTFCDOFLOPIGGS-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Zn++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Zn+2]
• Formula: Zn
• Name: ZINC ION
• ChEMBL: CHEMBL1236970
• DrugBank: DB14532
• PDB chain: 1dv6 Chain T Residue 2010

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1dv6 Determination of the binding sites of the proton transfer inhibitors Cd2+ and Zn2+ in bacterial reaction centers.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): D124 H126 H128
• Binding residue (residue number reindexed from 1): D114 H116 H118
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0042314 bacteriochlorophyll binding
• GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity

Biological Process

• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0016020 membrane
• GO:0030077 plasma membrane light-harvesting complex
• GO:0042717 plasma membrane-derived chromatophore membrane

External links

• PDB: RCSB:1dv6, PDBe:1dv6, PDBj:1dv6
• PDBsum: 1dv6
• PubMed: 10677497
• UniProt: P0C0Y7|RCEH_CERSP Reaction center protein H chain (Gene Name=puhA)