Structure of PDB 8qv2 Chain Sn Binding Site BS01

Receptor Information
>8qv2 Chain Sn (length=64) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EQEVREHQMKKERFDRALESKLLGKRHITYANSDISNKELYINEIKSLKH
EIKELRKEKNDTLN
Ligand information
>8qv2 Chain Sm (length=20) Species: 4932 (Saccharomyces cerevisiae) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EIKSLKHEIKELRKEKNDTL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8qv2 Structure of the native gamma-tubulin ring complex capping spindle microtubules.
Resolution9.2 Å
Binding residue
(original residue number in PDB)		L168 I172 L175 R176 K179
Binding residue
(residue number reindexed from 1)		L48 I52 L55 R56 K59
Enzymatic activity
Enzyme Commision number ?
External links