Structure of PDB 6y0g Chain SZ Binding Site BS01

Receptor Information
>6y0g Chain SZ (length=86) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLITPAVVSERL
KIRGSLARAALQELLSKGLIKLVSKHRAQVIYTRNT
Ligand information
>6y0g Chain B4 (length=76) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gcccggauagcucagucgguagagcaggggauugaaaauccccguguccu
ugguucgauuccgaguccgggcacca
<<<<<<<..<<<<........>>>><<<<<<<.....>>>>>>.>...<<
<<<.......>>>>>>>>>>>>....
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB6y0g Dynamics of uS19 C-Terminal Tail during the Translation Elongation Cycle in Human Ribosomes.
Resolution3.2 Å
Binding residue
(original residue number in PDB)		K31 K33
Binding residue
(residue number reindexed from 1)		K4 K6
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0042274 ribosomal small subunit biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0014069 postsynaptic density
GO:0015935 small ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6y0g, PDBe:6y0g, PDBj:6y0g
PDBsum6y0g
PubMed32268098
UniProtP62851|RS25_HUMAN Small ribosomal subunit protein eS25 (Gene Name=RPS25)

[Back to BioLiP]