Structure of PDB 7og1 Chain SSS Binding Site BS01

Receptor Information
>7og1 Chain SSS (length=142) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFV
EFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCE
LDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7og1 FCHO controls AP2's initiating role in endocytosis through a PtdIns(4,5)P 2 -dependent switch.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		L65 N97 V98 C99 E100 L101
Binding residue
(residue number reindexed from 1)		L65 N97 V98 C99 E100 L101
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0035615 clathrin adaptor activity
Biological Process
GO:0006886 intracellular protein transport
GO:0006897 endocytosis
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0048488 synaptic vesicle endocytosis
GO:0072583 clathrin-dependent endocytosis
GO:0098884 postsynaptic neurotransmitter receptor internalization
Cellular Component
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0009898 cytoplasmic side of plasma membrane
GO:0030117 membrane coat
GO:0030122 AP-2 adaptor complex
GO:0045202 synapse
GO:0071944 cell periphery
GO:0098793 presynapse
GO:0098794 postsynapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7og1, PDBe:7og1, PDBj:7og1
PDBsum7og1
PubMed35486718
UniProtP62743|AP2S1_MOUSE AP-2 complex subunit sigma (Gene Name=Ap2s1)

[Back to BioLiP]