Structure of PDB 8fld Chain SL Binding Site BS01

Receptor Information
>8fld Chain SL (length=238) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QLDKEQVRKAVDALLTHCKSRKNNYGLLLNENESLFLMVVLWKIPSKELR
VRLTLPHSIRSDSEDICLFTKDEPNSTPEKTEQFYRKLLNKHGIKTVSQI
ISLQTLKKEYKSYEAKLRLLSSFDFFLTDARIRRLLPSLIGRHFYQRKKV
PVSVNLLSKNLSREINDCIGGTVLNISKSGSCSAIRIGHVGMQIEHIIEN
IVAVTKGLSEKLPEKWESVKLLFVKTEKSAALPIFSSF
Ligand information
>8fld Chain L2 (length=72) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccgaucaaucgcccccggggugcgcggcugggggcucgcagggccccucc
gucccccuaagcgcagacgaga
.........<<<<<<..>>>.>>>.....<<<<<..<<.<<<<.>>>>.>
>.>>>>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fld Principles of human pre-60S biogenesis
Resolution2.58 Å
Binding residue
(original residue number in PDB)
R50 M67 K100 D101 L132 K136 K140 S141 Y142 E143 A159 R160 R162 R163 L164 S167 L168 G170 R171 H172 Y174 R176 K177 S208 G209 C211 A213 K240 K249 E256 K257 S258
Binding residue
(residue number reindexed from 1)
R21 M38 K71 D72 L103 K107 K111 S112 Y113 E114 A130 R131 R133 R134 L135 S138 L139 G141 R142 H143 Y145 R147 K148 S179 G180 C182 A184 K211 K220 E227 K228 S229
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003730 mRNA 3'-UTR binding
GO:0005515 protein binding
GO:0045296 cadherin binding
GO:0048027 mRNA 5'-UTR binding
Biological Process
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001649 osteoblast differentiation
GO:0032880 regulation of protein localization
GO:0042981 regulation of apoptotic process
GO:2000772 regulation of cellular senescence
Cellular Component
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0016020 membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fld, PDBe:8fld, PDBj:8fld
PDBsum8fld
PubMed37410842
UniProtO76021|RL1D1_HUMAN Ribosomal L1 domain-containing protein 1 (Gene Name=RSL1D1)

[Back to BioLiP]