Structure of PDB 8fkz Chain SI Binding Site BS01

Receptor Information
>8fkz Chain SI (length=233) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LVPENLLKKRKAYQALKATQAKQALLAKKEQKKGRFKRLESFLHDSWRQK
RDKVRLRRLEVKPHALELPDKHSLAFVVRIERIDGVSLLVQRTIARLRLK
KIFSGVFVKVTPQNLKMLRIVEPYVTWGFPNLKSVRELILKRGQAKVKNK
TIPLTDNTVIEEHLGKFGVICLEDLIHEIAFPGKHFQEISWFLCPFHLSV
ARHATKNRVGFLKEMGTPGYRGERINQLIRQLN
Ligand information
>8fkz Chain L2 (length=68) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccgaucaaucgcccccggggugcgcggcugggggcucgcagggccccucc
gucccccuaagcgcagac
.........<<<<<<..>>>.>>>.....<<<<<..<<.<<<<.>>>>.>
>.>>>>>...........
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fkz Principles of human pre-60 S biogenesis.
Resolution3.04 Å
Binding residue
(original residue number in PDB)
L65 H66 W69 K72 R80 P85 H86 R230
Binding residue
(residue number reindexed from 1)
L43 H44 W47 K50 R58 P63 H64 R208
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0001825 blastocyst formation
Cellular Component
GO:0005730 nucleolus
GO:0005739 mitochondrion
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fkz, PDBe:8fkz, PDBj:8fkz
PDBsum8fkz
PubMed37410842
UniProtQ6DKI1|RL7L_HUMAN Ribosomal protein uL30-like (Gene Name=RPL7L1)

[Back to BioLiP]