Structure of PDB 8fld Chain SH Binding Site BS01

Receptor Information
>8fld Chain SH (length=150) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFV
EFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQP
SYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQ
Ligand information
>8fld Chain L2 (length=72) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ccgaucaaucgcccccggggugcgcggcugggggcucgcagggccccucc
gucccccuaagcgcagacgaga
.........<<<<<<..>>>.>>>.....<<<<<..<<.<<<<.>>>>.>
>.>>>>>...............
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8fld Principles of human pre-60S biogenesis
Resolution2.58 Å
Binding residue
(original residue number in PDB)
Y48 R50 H51 R75 L76 S77 R78 S79 R81 T82 N84 K86 Y88 F90 E113 R114 H127 E129 L130 K132 D133 F138 K139 P141 S142 P144 S145 R148 Y149 R153 M161 R164 K168
Binding residue
(residue number reindexed from 1)
Y7 R9 H10 R34 L35 S36 R37 S38 R40 T41 N43 K45 Y47 F49 E72 R73 H86 E88 L89 K91 D92 F97 K98 P100 S101 P103 S104 R107 Y108 R112 M120 R123 K127
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0009303 rRNA transcription
GO:0016072 rRNA metabolic process
GO:0065003 protein-containing complex assembly
Cellular Component
GO:0000794 condensed nuclear chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005737 cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8fld, PDBe:8fld, PDBj:8fld
PDBsum8fld
PubMed37410842
UniProtQ9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein (Gene Name=NIFK)

[Back to BioLiP]