Structure of PDB 8fkz Chain SH Binding Site BS01

Receptor Information

>8fkz Chain SH (length=150) Species: 9606 (Homo sapiens)

LTPGVVYVRHLPNLLDETQIFSYFSQFGTVTRFRLSRSKRTGNSKGYAFV
EFESEDVAKIVAETMNNYLFGERLLECHFMPPEKVHKELFKDWNIPFKQP
SYPSVKRYNRNRTLTQKLRMEERFKKKERLLRKKLAKKGIDYDFPSLILQ

Ligand information

>8fkz Chain L2 (length=68)

ccgaucaaucgcccccggggugcgcggcugggggcucgcagggccccucc
gucccccuaagcgcagac

.........<<<<<<..>>>.>>>.....<<<<<..<<.<<<<.>>>>.>
>.>>>>>...........

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8fkz Principles of human pre-60 S biogenesis.
• Resolution: 3.04 Å
• Binding residue (original residue number in PDB): R50 H51 R75 S77 R78 S79 T82 K86 G87 Y88 E113 R114 H127 E129 L130 K132 F138 S142 P144 S145 Y149
• Binding residue (residue number reindexed from 1): R9 H10 R34 S36 R37 S38 T41 K45 G46 Y47 E72 R73 H86 E88 L89 K91 F97 S101 P103 S104 Y108

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0005515 protein binding

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0009303 rRNA transcription
• GO:0016072 rRNA metabolic process
• GO:0065003 protein-containing complex assembly

Cellular Component

• GO:0000794 condensed nuclear chromosome
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005694 chromosome
• GO:0005730 nucleolus
• GO:0005737 cytoplasm

External links

• PDB: RCSB:8fkz, PDBe:8fkz, PDBj:8fkz
• PDBsum: 8fkz
• PubMed: 37410842
• UniProt: Q9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein (Gene Name=NIFK)